PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr027988.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 308aa    MW: 34562.7 Da    PI: 9.8244
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr027988.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.65e-072871344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     rWT  E + + +a + +  +   +W+ +a++++ g+t  ++k  +
      Pbr027988.1 28 RWTSAENKMFENALAVYDRDtpdRWHQVAAMIP-GKTVRDVKKQY 71
                     9*****************99*************.********987 PP

2Myb_DNA-binding48.22.6e-15137181347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
      Pbr027988.1 137 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVVTRTPTQVASHAQKY 181
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-41873IPR009057Homeodomain-like
PROSITE profilePS512937.5152479IPR017884SANT domain
SMARTSM007175.3E-82577IPR001005SANT/Myb domain
CDDcd001672.40E-62874No hitNo description
SuperFamilySSF466893.09E-102878IPR009057Homeodomain-like
PROSITE profilePS5129422.032130186IPR017930Myb domain
SuperFamilySSF466897.18E-17132185IPR009057Homeodomain-like
TIGRFAMsTIGR015578.8E-18133185IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.609.6E-13134181IPR009057Homeodomain-like
SMARTSM007172.7E-13134184IPR001005SANT/Myb domain
PfamPF002495.4E-13137181IPR001005SANT/Myb domain
CDDcd001672.51E-11137182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MKFEMEILSP SSYSSTSNWL VEESKSARWT SAENKMFENA LAVYDRDTPD RWHQVAAMIP  60
GKTVRDVKKQ YEELEADVGQ IEAGLVPIPG YSTSPFTLEW VNRHGGYEGF KQQACGIGGK  120
RSSLNRPSDH ERKKGVPWTE EEHKLFLMGL KKYGKGDWRN ISRNFVVTRT PTQVASHAQK  180
YFIRQISGGK DKRRASIHDI TTVNLNDMRT PSPDNKSPLS PELPPHPNSA ATARVPFQWH  240
QPQGGGVNMG FNQGHGNMFM SSHPYGISSY GLKMQGQDLL KGAANNSYYG PQNLSFQMQS  300
SQHYRHG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1729941176RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009337308.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-136DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM5VZC70.0M5VZC7_PRUPE; Uncharacterized protein
STRINGVIT_06s0004g06100.t011e-164(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-106Homeodomain-like transcriptional regulator